PDB entry 3odz

View 3odz on RCSB PDB site
Description: Crystal structure of P38alpha Y323R active mutant
Class: transferase
Keywords: MAP kinase, p38, TCR induced alternative activation, kinase fold, kinase, substrates, TRANSFERASE
Deposited on 2010-08-12, released 2011-01-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539
      • engineered mutation (322)
    Domains in SCOPe 2.06: d3odzx_
  • Heterogens: BOG, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3odzX (X:)
    msqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadprdqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3odzX (X:)
    erptfyrqelnktiwevperyqnlspvgsvcaafdtktglrvavkklsrpfqsiihakrt
    yrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddhvq
    fliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglavatrwyrapeimlnwm
    hynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarny
    iqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddep
    vadprdqsfesrdllidewksltydevisfvpppl