PDB entry 3ocs

View 3ocs on RCSB PDB site
Description: Crystal structure of bruton's tyrosine kinase in complex with inhibitor CGI1746
Class: transferase/transferase inhibitor
Keywords: Tyrosine kinase, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-08-10, released 2010-11-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Gene: BTK, AGMX1, ATK, BPK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06187 (Start-264)
      • expression tag (265-266)
    Domains in SCOPe 2.05: d3ocsa_
  • Heterogens: SO4, BME, 746, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ocsA (A:)
    mgsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmn
    lsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceamey
    leskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmy
    skfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimy
    scwhekaderptfkillsnildvmdenlygq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ocsA (A:)
    weidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlsh
    eklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyles
    kqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskf
    ssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscw
    hekaderptfkillsnildvmden