PDB entry 3ocf

View 3ocf on RCSB PDB site
Description: Crystal structure of fumarate lyase:delta crystallin from Brucella melitensis in native form
Class: lyase
Keywords: fumarate lyase, fumarase, brucellosis, orchitis, epididymitis, mastitis, dehydration of fumarate to malate, Kreb's cycle, citric acid cycle, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, LYASE
Deposited on 2010-08-09, released 2010-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.174
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fumarate lyase:Delta crystallin
    Species: Brucella melitensis [TaxId:359391]
    Gene: aspA, BAB1_1959
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ocfa_
  • Chain 'B':
    Compound: Fumarate lyase:Delta crystallin
    Species: Brucella melitensis [TaxId:359391]
    Gene: aspA, BAB1_1959
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YLW1 (22-End)
      • expression tag (21)
    Domains in SCOPe 2.07: d3ocfb1, d3ocfb2
  • Chain 'C':
    Compound: Fumarate lyase:Delta crystallin
    Species: Brucella melitensis [TaxId:359391]
    Gene: aspA, BAB1_1959
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ocfc_
  • Chain 'D':
    Compound: Fumarate lyase:Delta crystallin
    Species: Brucella melitensis [TaxId:359391]
    Gene: aspA, BAB1_1959
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YLW1 (22-End)
      • expression tag (20-21)
    Domains in SCOPe 2.07: d3ocfd1, d3ocfd2
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ocfA (A:)
    mahhhhhhmgtleaqtqgpgsmtrreqdslgerdipmdayfgiqtlravenfslsdvaln
    hipalvralamvkkaaatanyklrqlpepkyaaivaacddiidgllmeqfvvdvfqggag
    tssnmnanevianralehlgrprgdyqtihpnddvnmsqstndvyptavrlalllsqnqv
    qtalhrliaafeakgrefatvikigrtqlqdavpitlgqefeafaatlredtarleevaa
    lfrevnlggtaigtrinashayaeqaivelsqisgielkatgnlveaswdtgafvtfsgi
    lrriavklskiandlrllssgprsglgeirlpavqpgssimpgkvnpvipesvnqvcyqv
    igndltvtmaaesgqlqlnafeplivynilssmrllgramtnlaercvdgieanvercra
    gaeesislatalvpvvgyaraaeiakqalasgqtvmevaiskgldasaltimldplrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ocfA (A:)
    trreqdslgerdipmdayfgiqtlravenfslsdvalnhipalvralamvkkaaatanyk
    lrqlpepkyaaivaacddiidgllmeqfvvdvfqggagtssnmnanevianralehlgrp
    rgdyqtihpnddvnmsqstndvyptavrlalllsqnqvqtalhrliaafeakgrefatvi
    kigrtqlqdavpitlgqefeafaatlredtarleevaalfrevnlggayaeqaivelsqi
    sgielkatgnlveaswdtgafvtfsgilrriavklskiandlrllssgprsglgeirlpa
    vqpgssimpgkvnpvipesvnqvcyqvigndltvtmaaesgqlqlnafeplivynilssm
    rllgramtnlaercvdgieanvercragaeesislatalvpvvgyaraaeiakqalasgq
    tvmevaiskgldasaltimldplr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ocfB (B:)
    mahhhhhhmgtleaqtqgpgsmtrreqdslgerdipmdayfgiqtlravenfslsdvaln
    hipalvralamvkkaaatanyklrqlpepkyaaivaacddiidgllmeqfvvdvfqggag
    tssnmnanevianralehlgrprgdyqtihpnddvnmsqstndvyptavrlalllsqnqv
    qtalhrliaafeakgrefatvikigrtqlqdavpitlgqefeafaatlredtarleevaa
    lfrevnlggtaigtrinashayaeqaivelsqisgielkatgnlveaswdtgafvtfsgi
    lrriavklskiandlrllssgprsglgeirlpavqpgssimpgkvnpvipesvnqvcyqv
    igndltvtmaaesgqlqlnafeplivynilssmrllgramtnlaercvdgieanvercra
    gaeesislatalvpvvgyaraaeiakqalasgqtvmevaiskgldasaltimldplrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ocfB (B:)
    mtrreqdslgerdipmdayfgiqtlravenfslsdvalnhipalvralamvkkaaatany
    klrqlpepkyaaivaacddiidgllmeqfvvdvfqggagtssnmnanevianralehlgr
    prgdyqtihpnddvnmsqstndvyptavrlalllsqnqvqtalhrliaafeakgrefatv
    ikigrtqlqdavpitlgqefeafaatlredtarleevaalfrevnlgghayaeqaivels
    qisgielkatgnlveaswdtgafvtfsgilrriavklskiandlrllssgprsglgeirl
    pavqpgssimpgkvnpvipesvnqvcyqvigndltvtmaaesgqlqlnafeplivynils
    smrllgramtnlaercvdgieanvercragaeesislatalvpvvgyaraaeiakqalas
    gqtvmevais
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ocfC (C:)
    mahhhhhhmgtleaqtqgpgsmtrreqdslgerdipmdayfgiqtlravenfslsdvaln
    hipalvralamvkkaaatanyklrqlpepkyaaivaacddiidgllmeqfvvdvfqggag
    tssnmnanevianralehlgrprgdyqtihpnddvnmsqstndvyptavrlalllsqnqv
    qtalhrliaafeakgrefatvikigrtqlqdavpitlgqefeafaatlredtarleevaa
    lfrevnlggtaigtrinashayaeqaivelsqisgielkatgnlveaswdtgafvtfsgi
    lrriavklskiandlrllssgprsglgeirlpavqpgssimpgkvnpvipesvnqvcyqv
    igndltvtmaaesgqlqlnafeplivynilssmrllgramtnlaercvdgieanvercra
    gaeesislatalvpvvgyaraaeiakqalasgqtvmevaiskgldasaltimldplrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ocfC (C:)
    trreqdslgerdipmdayfgiqtlravenfslsdvalnhipalvralamvkkaaatanyk
    lrqlpepkyaaivaacddiidgllmeqfvvdvfqggagtssnmnanevianralehlgrp
    rgdyqtihpnddvnmsqstndvyptavrlalllsqnqvqtalhrliaafeakgrefatvi
    kigrtqlqdavpitlgqefeafaatlredtarleevaalfrevnlggtayaeqaivelsq
    isgielkatgnlveaswdtgafvtfsgilrriavklskiandlrllssgprsglgeirlp
    avqpgssimpgkvnpvipesvnqvcyqvigndltvtmaaesgqlqlnafeplivynilss
    mrllgramtnlaercvdgieanvercragaeesislatalvpvvgyaraaeiakqalasg
    qtvmevaiskgldasaltimldpl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ocfD (D:)
    mahhhhhhmgtleaqtqgpgsmtrreqdslgerdipmdayfgiqtlravenfslsdvaln
    hipalvralamvkkaaatanyklrqlpepkyaaivaacddiidgllmeqfvvdvfqggag
    tssnmnanevianralehlgrprgdyqtihpnddvnmsqstndvyptavrlalllsqnqv
    qtalhrliaafeakgrefatvikigrtqlqdavpitlgqefeafaatlredtarleevaa
    lfrevnlggtaigtrinashayaeqaivelsqisgielkatgnlveaswdtgafvtfsgi
    lrriavklskiandlrllssgprsglgeirlpavqpgssimpgkvnpvipesvnqvcyqv
    igndltvtmaaesgqlqlnafeplivynilssmrllgramtnlaercvdgieanvercra
    gaeesislatalvpvvgyaraaeiakqalasgqtvmevaiskgldasaltimldplrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ocfD (D:)
    smtrreqdslgerdipmdayfgiqtlravenfslsdvalnhipalvralamvkkaaatan
    yklrqlpepkyaaivaacddiidgllmeqfvvdvfqggagtssnmnanevianralehlg
    rprgdyqtihpnddvnmsqstndvyptavrlalllsqnqvqtalhrliaafeakgrefat
    vikigrtqlqdavpitlgqefeafaatlredtarleevaalfrevnlggtahayaeqaiv
    elsqisgielkatgnlveaswdtgafvtfsgilrriavklskiandlrllssgprsglge
    irlpavqpgssimpgkvnpvipesvnqvcyqvigndltvtmaaesgqlqlnafeplivyn
    ilssmrllgramtnlaercvdgieanvercragaeesislatalvpvaraaeiakqalas
    gqtvmevais