PDB entry 3ocb

View 3ocb on RCSB PDB site
Description: Akt1 kinase domain with pyrrolopyrimidine inhibitor
Class: transferase
Keywords: Serine-Threonine Kinase, TRANSFERASE
Deposited on 2010-08-09, released 2010-09-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.217
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: v-akt murine thymoma viral oncogene homolog 1 (AKT1)
    Species: Homo sapiens [TaxId:9606]
    Gene: AKT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2RAM5 (4-End)
      • engineered mutation (333)
    Domains in SCOPe 2.01: d3ocba_
  • Chain 'B':
    Compound: v-akt murine thymoma viral oncogene homolog 1 (AKT1)
    Species: Homo sapiens [TaxId:9606]
    Gene: AKT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2RAM5 (4-End)
      • engineered mutation (333)
    Domains in SCOPe 2.01: d3ocbb_
  • Chain 'C':
    Compound: GSK 3 beta peptide
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3OCB (0-9)
  • Chain 'D':
    Compound: GSK 3 beta peptide
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3OCB (0-9)
  • Heterogens: XM1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ocbA (A:)
    gamarvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtlten
    rvlqnsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeivs
    aldylhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylape
    vledndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaksl
    lsgllkkdpkqrlgggsedakeimqhrffagivwqhvyekklsppfkpqvtsetdtryfd
    eeftaqmititppdqddsmecvdserrphfpqfdysassta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ocbA (A:)
    rvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtltenrvlq
    nsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeivsaldy
    lhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylapevled
    ndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaksllsgl
    lkkdpkqrlgggsedakeimqhrffagivwqhvyekklsppfkpqvtsetdtryfdeeft
    aqmrphfpqfdysass
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ocbB (B:)
    gamarvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtlten
    rvlqnsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeivs
    aldylhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylape
    vledndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaksl
    lsgllkkdpkqrlgggsedakeimqhrffagivwqhvyekklsppfkpqvtsetdtryfd
    eeftaqmititppdqddsmecvdserrphfpqfdysassta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ocbB (B:)
    rvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtltenrvlq
    nsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeivsaldy
    lhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylapevled
    ndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaksllsgl
    lkkdpkqrlgggsedakeimqhrffagivwqhvyekklsppfkpqvtsetdtryfdeeft
    aqmititrphfpqfdysass
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.