PDB entry 3oc7

View 3oc7 on RCSB PDB site
Description: Crystal structure of an enoyl-CoA hydratase from Mycobacterium avium
Class: Lyase
Keywords: Seattle Structural Genomics Center for Infectious Disease, SSGCID, non-pathogenic Mycobacterium species, ortholog, Johne's disease in cattle, paratuberculosis, Crohn's disease in humans, hydratase, crotonase, fatty acid metabolism, Lyase
Deposited on 2010-08-09, released 2010-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-coa hydratase
    Species: Mycobacterium avium [TaxId:243243]
    Gene: MAV_1087
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oc7a_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oc7A (A:)
    gpgsmdalvdyagpaatggpvarltlnsphnrnalstalvsqlhqglrdassdpavrvvv
    lahtggtfcagadlseagsggspssaydmaveraremaalmraivesrlpviaaidghvr
    aggfglvgacdiavagprssfaltearigvapaiisltllpklsaraaaryyltgekfda
    rraeeiglitmaaedldaaidqlvtdvgrgspqglaaskalttaavlerfdrdaerlaee
    sarlfvsdearegmlaflekrspnwts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oc7A (A:)
    mdalvdyagpaatggpvarltlnsphnrnalstalvsqlhqglrdassdpavrvvvlaht
    ggtfcagadsaydmaveraremaalmraivesrlpviaaidghvraggfglvgacdiava
    gprssfaltearigvapaiisltllpklsaraaaryyltgekfdarraeeiglitmaaed
    ldaaidqlvtdvgrgspqglaaskalttaavlerfdrdaerlaeesarlfvsdearegml
    aflekrspnwt