PDB entry 3obx

View 3obx on RCSB PDB site
Description: Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 Gag P7A mutant peptide
Class: protein transport
Keywords: Protein tranport, ubiquitin, HIV-1 Gag, PROTEIN TRANSPORT
Deposited on 2010-08-09, released 2010-12-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.206
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor susceptibility gene 101 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TSG101
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99816 (Start-145)
      • see remark 999 (46-48)
    Domains in SCOPe 2.06: d3obxa_
  • Chain 'B':
    Compound: gag polyprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72497 (0-8)
      • engineered mutation (2)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3obxA (A:)
    gamgsavsesqlkkmvskykyrdltvretvnvitlykdlkpvldsygtgsrelmnltgti
    pvpyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkh
    pqsdllgliqvmivvfgdeppvfsrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3obxA (A:)
    vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsygtgsrelmnltgtipvpyrg
    ntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqsdll
    gliqvmivvfgdeppvfsrp
    

  • Chain 'B':
    No sequence available.