PDB entry 3obv

View 3obv on RCSB PDB site
Description: Autoinhibited Formin mDia1 Structure
Class: structural protein
Keywords: autoinhibition, actin, nucleation, cytoskeleton, structural protein
Deposited on 2010-08-09, released 2010-11-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.2
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein diaphanous homolog 1
    Species: Mus musculus [TaxId:10090]
    Gene: Diaph1, Diap1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3obva_
  • Chain 'B':
    Compound: Protein diaphanous homolog 1
    Species: Mus musculus [TaxId:10090]
    Gene: Diaph1, Diap1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3obvb_
  • Chain 'C':
    Compound: Protein diaphanous homolog 1
    Species: Mus musculus [TaxId:10090]
    Gene: Diaph1, Diap1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3obvc_
  • Chain 'D':
    Compound: Protein diaphanous homolog 1
    Species: Mus musculus [TaxId:10090]
    Gene: Diaph1, Diap1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3obvd_
  • Chain 'E':
    Compound: Protein diaphanous homolog 1
    Species: Mus musculus [TaxId:10090]
    Gene: Diaph1, Diap1
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Protein diaphanous homolog 1
    Species: Mus musculus [TaxId:10090]
    Gene: Diaph1, Diap1
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Protein diaphanous homolog 1
    Species: Mus musculus [TaxId:10090]
    Gene: Diaph1, Diap1
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Protein diaphanous homolog 1
    Species: Mus musculus [TaxId:10090]
    Gene: Diaph1, Diap1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SUC

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3obvA (A:)
    essrsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlh
    dekeetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmida
    akllsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlin
    alitpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgr
    lddirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvs
    qivlhkngtdpdfkcrhlqidierlvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3obvA (A:)
    essrsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlh
    dekeetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmida
    akllsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlin
    alitpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgr
    lddirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvs
    qivlhkngtdpdfkcrhlqidi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3obvB (B:)
    essrsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlh
    dekeetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmida
    akllsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlin
    alitpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgr
    lddirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvs
    qivlhkngtdpdfkcrhlqidierlvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3obvB (B:)
    ssrsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhd
    eydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaakllsalc
    ilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinalitpaee
    ldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrlddirmem
    ddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqivlhkng
    tdpdfkcrhlqidierlvd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3obvC (C:)
    essrsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlh
    dekeetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmida
    akllsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlin
    alitpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgr
    lddirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvs
    qivlhkngtdpdfkcrhlqidierlvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3obvC (C:)
    essrsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlh
    dekeetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmida
    akllsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlin
    alitpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgr
    lddirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvs
    qivlhkngtdpdfkcrhlqidi
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3obvD (D:)
    essrsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlh
    dekeetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmida
    akllsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlin
    alitpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgr
    lddirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvs
    qivlhkngtdpdfkcrhlqidierlvd
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.