PDB entry 3obt

View 3obt on RCSB PDB site
Description: Crystal structure of Botulinum neurotoxin serotype D ligand binding domain in complex with N-Acetylneuraminic acid
Class: hydrolase
Keywords: neurotoxin, gangalioside, HYDROLASE
Deposited on 2010-08-09, released 2010-09-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.174
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin type D
    Species: Clostridium botulinum [TaxId:1491]
    Gene: BOTD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19321 (7-420)
      • expression tag (3-6)
      • expression tag (421-422)
    Domains in SCOPe 2.05: d3obta1, d3obta2
  • Heterogens: SLB, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3obtA (A:)
    mrgsamasindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkii
    vnlnnnilysaiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewil
    qdvnrkykslifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldev
    kldktivfgidenidenqmlwirdfnifskelsnedinivyegqilrnvikdywgnplkf
    dteyyiindnyidryiapesnvlvlvqypdrsklytgnpitiksvsdknpysrilngdni
    ilhmlynsrkymiirdtdtiyatqggecsqncvyalklqsnlgnygigifsiknivsknk
    ycsqifssfrentmlladiykpwrfsfknaytpvavtnyetkllstssfwkfisrdpgwv
    epptpgwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3obtA (A:)
    samasindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnl
    nnnsaiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrk
    ykslifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldkti
    vfgidenidenqmlwirdfnifskelsnedinivyegqilrnvikdywgnplkfdteyyi
    indnyidryiapesnvlvlvqypdrsklytgnpitiksvsdknpysrilngdniilhmly
    nsrkymiirdtdtiyaecsqncvyalklqsnlgnygigifsiknivknkycsqifssfre
    ntmlladiykpwrfsfknaytpvavtnyetkllstssfwkfisrdpgwvepp