PDB entry 3obq

View 3obq on RCSB PDB site
Description: Crystal Structure of the Tsg101 UEV domain in complex with a human HRS PSAP peptide
Class: protein transport
Keywords: Protein Transprot, Ubiquitin Binding, PROTEIN TRANSPORT
Deposited on 2010-08-09, released 2010-12-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-27, with a file datestamp of 2015-05-22.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor susceptibility gene 101 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TSG101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3obqa_
  • Chain 'B':
    Compound: hepatocyte growth factor-regulated tyrosine kinase substrate
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3obqA (A:)
    gamgsavsesqlkkmvskykyrdltvretvnvitlykdlkpvldsygtgsrelmnltgti
    pvpyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkh
    pqsdllgliqvmivvfgdeppvfsrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3obqA (A:)
    avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsygtgsrelmnltgtipvpyr
    gntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqsdl
    lgliqvmivvfgdeppvfsrp
    

  • Chain 'B':
    No sequence available.