PDB entry 3obd

View 3obd on RCSB PDB site
Description: Complex of G65T Myoglobin with Phenol in its Proximal Cavity
Class: oxygen transport
Keywords: phenol binding, OXYGEN TRANSPORT
Deposited on 2010-08-06, released 2011-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: 0.142
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • engineered mutation (65)
    Domains in SCOPe 2.07: d3obda_
  • Heterogens: HEM, IPH, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3obdA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhtvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqg