PDB entry 3obc

View 3obc on RCSB PDB site
Description: Crystal structure of a pyrophosphatase (AF1178) from Archaeoglobus fulgidus at 1.80 A resolution
Class: hydrolase
Keywords: dimeric four alpha-helical bundle, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-biology, hydrolase
Deposited on 2010-08-06, released 2010-09-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.223
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyrophosphatase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_1178
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29089 (12-End)
      • expression tag (4-11)
    Domains in SCOPe 2.01: d3obca_
  • Chain 'B':
    Compound: pyrophosphatase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_1178
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29089 (12-End)
      • expression tag (5-11)
    Domains in SCOPe 2.01: d3obcb_
  • Heterogens: ZN, CL, PGE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3obcA (A:)
mgsdkihhhhhhmeelldilrefrdsrgwlkyhtpknlavsisievaelleifqwtrssd
eefevlerrkgeveeeiadvliyllflcdvaeinpieavkrkmeknerkypknrvhef

    Sequence, based on observed residues (ATOM records): (download) 
    >3obcA (A:)
kihhhhhhmeelldilrefrdsrgwlkyhtpknlavsisievaelleifqwtrssdeefe
vlerrkgeveeeiadvliyllflcdvaeinpieavkrkmeknerkypk

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3obcB (B:)
mgsdkihhhhhhmeelldilrefrdsrgwlkyhtpknlavsisievaelleifqwtrssd
eefevlerrkgeveeeiadvliyllflcdvaeinpieavkrkmeknerkypknrvhef

    Sequence, based on observed residues (ATOM records): (download) 
    >3obcB (B:)
ihhhhhhmeelldilrefrdsrgwlkyhtpknlavsisievaelleifqwtrssdeefev
lerrkgeveeeiadvliyllflcdvaeinpieavkrkmeknerkypk