PDB entry 3obb

View 3obb on RCSB PDB site
Description: Crystal structure of a possible 3-hydroxyisobutyrate Dehydrogenase from pseudomonas aeruginosa pao1
Class: oxidoreductase
Keywords: Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, OXIDOREDUCTASE, alpha-beta, Serine Dehydrogenase
Deposited on 2010-08-06, released 2010-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable 3-hydroxyisobutyrate dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA0743
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3obba1, d3obba2
  • Heterogens: ACT, EDO, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3obbA (A:)
    ghmkqiafiglghmgapmatnllkagyllnvfdlvqsavdglvaagasaarsardavqga
    dvvismlpasqhveglyldddgllahiapgtlvlecstiaptsarkihaaarerglamld
    apvsggtagaaagtltfmvggdaealekarplfeamgrnifhagpdgagqvakvcnnqll
    avlmigtaeamalgvangleakvlaeimrrssggnwalevynpwpgvmenapasrdysgg
    fmaqlmakdlglaqeaaqasasstpmgslalslyrlllkqgyaerdfsvvqklfdptqgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3obbA (A:)
    mkqiafiglghmgapmatnllkagyllnvfdlvqsavdglvaagasaarsardavqgadv
    vismlpasqhveglyldddgllahiaptlvlecstiaptsarkihaaarerglamldapv
    sggtagaaagtltfmvggdaealekarplfeamgrnifhagpdgagqvakvcnnqllavl
    migtaeamalgvangleakvlaeimrrssggnwalevynpwpgvmenapasrdysggfma
    qlmakdlglaqeaaqasasstpmgslalslyrlllkqgyaerdfsvvqklfdptq