PDB entry 3ob0

View 3ob0 on RCSB PDB site
Description: A non-self sugar mimic of the HIV glycan shield shows enhanced antigenicity
Class: immune system
Keywords: Fab, IMMUNE SYSTEM
Deposited on 2010-08-06, released 2011-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.234
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: FAB 2G12, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OB0 (0-223)
  • Chain 'K':
    Compound: FAB 2G12, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OB0 (0-212)
    Domains in SCOPe 2.07: d3ob0k1, d3ob0k2
  • Chain 'L':
    Compound: FAB 2G12, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OB0 (0-End)
    Domains in SCOPe 2.07: d3ob0l1, d3ob0l2
  • Chain 'M':
    Compound: FAB 2G12, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OB0 (0-223)
  • Heterogens: 2M6, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ob0K (K:)
    avvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
    rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3ob0L (L:)
    avvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
    rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ob0L (L:)
    avvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
    rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'M':
    No sequence available.