PDB entry 3oaz

View 3oaz on RCSB PDB site
Description: A non-self sugar mimic of the HIV glycan shield shows enhanced antigenicity
Class: immune system
Keywords: Fab, IMMUNE SYSTEM
Deposited on 2010-08-06, released 2011-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: FAB 2G12, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OAZ (0-222)
  • Chain 'K':
    Compound: FAB 2G12, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OAZ (0-212)
    Domains in SCOPe 2.08: d3oazk1, d3oazk2
  • Chain 'L':
    Compound: FAB 2G12, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OAZ (0-212)
    Domains in SCOPe 2.08: d3oazl1, d3oazl2
  • Chain 'M':
    Compound: FAB 2G12, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OAZ (0-End)
  • Heterogens: GOL, CL, 2M5, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3oazK (K:)
    avvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
    rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3oazL (L:)
    avvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
    rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'M':
    No sequence available.