PDB entry 3oau

View 3oau on RCSB PDB site
Description: Antibody 2G12 Recognizes Di-Mannose Equivalently in Domain- and Non-Domain-Exchanged Forms, but only binds the HIV-1 Glycan Shield if Domain-Exchanged
Class: immune system
Keywords: Fab, IMMUNE SYSTEM
Deposited on 2010-08-05, released 2011-01-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: FAB 2G12, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OAU (0-End)
  • Chain 'L':
    Compound: FAB 2G12, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OAU (0-211)
    Domains in SCOPe 2.03: d3oaul1, d3oaul2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3oauL (L:)
    vvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvpsr
    fsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge