PDB entry 3oaf

View 3oaf on RCSB PDB site
Description: Structural and Kinetic Data for Antifolate Interactions Against Pneumocystis jirovecii, Pneumocystis carinii and Human Dihydrofolate Reductase and Thier Active Site Mutants
Class: oxidoreductase/inhibitor
Keywords: hDHFR inhibitor complexes, OXIDOREDUCTASE-INHIBITOR complex
Deposited on 2010-08-05, released 2011-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: DHFR, DHFRP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00374 (0-185)
      • engineered mutation (34)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d3oafa_
  • Heterogens: OAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3oafA (A:)
    vgslncivavsqnmgigkngdlpwpplrnefryfsrmtttssvegkqnlvimgkktwfsi
    pekfrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
    ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
    vyeknd