PDB entry 3oae

View 3oae on RCSB PDB site
Description: Crystal structure of HPV16 L1 Pentamer bound to Heparin oligosaccharides
Class: viral protein
Keywords: Jelly roll, Capsid protein, receptor HSPG, Virus capsid, VIRAL PROTEIN
Deposited on 2010-08-05, released 2010-11-17
Made obsolete by 5w1o on 2017-10-18

The last revision prior to the SCOPe 2.01 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.249
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: late major capsid protein l1
    Species: Human papillomavirus [TaxId:10566]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81007 (3-385)
      • expression tag (2)
      • engineered mutation (159)
      • engineered mutation (163)
    • Uniprot Q81007 (391-427)
      • engineered mutation (425)
  • Chain 'B':
    Compound: late major capsid protein l1
    Species: Human papillomavirus [TaxId:10566]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81007 (3-385)
      • expression tag (2)
      • engineered mutation (159)
      • engineered mutation (163)
    • Uniprot Q81007 (391-427)
      • engineered mutation (425)
  • Chain 'C':
    Compound: late major capsid protein l1
    Species: Human papillomavirus [TaxId:10566]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81007 (3-385)
      • expression tag (2)
      • engineered mutation (159)
      • engineered mutation (163)
    • Uniprot Q81007 (391-427)
      • engineered mutation (425)
  • Chain 'D':
    Compound: late major capsid protein l1
    Species: Human papillomavirus [TaxId:10566]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81007 (3-385)
      • expression tag (2)
      • engineered mutation (159)
      • engineered mutation (163)
    • Uniprot Q81007 (391-427)
      • engineered mutation (425)
    Domains in SCOPe 2.01: d3oaed_
  • Chain 'E':
    Compound: late major capsid protein l1
    Species: Human papillomavirus [TaxId:10566]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81007 (3-385)
      • expression tag (2)
      • engineered mutation (159)
      • engineered mutation (163)
    • Uniprot Q81007 (391-427)
      • engineered mutation (425)
  • Heterogens: JHM, IDS

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3oaeD (D:)
    gsavvstdeyvartniyyhagtsrllavghpyfpikkpnnnkilvpkvsglqyrvfrihl
    pdpnkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisghpllnklddtenasayaa
    nagvdnrecismdykqtqlcligckppigehwgkgspctqvavqpgdcpplelintviqd
    gdmvdtgfgamdfttlqanksevpldictsickypdyikmvsepygdslffylrreqmfv
    rhlfnragtvgenvpddlyikgsgstanlassnyfptpsgsmvtsdaqifnkpywlqraq
    ghnngicwgnqlfvtvvdttrstnmslcaaistsettykntnfkeylrhgeeydlqfifq
    lckitltadvmtyihsmnstiledwnggsggedplkkytfwevnlkekfsadldqfplgr
    kfllqlgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oaeD (D:)
    avvstdeyvartniyyhagtsrllavghpyfpikkpnnnkilvpkvsglqyrvfrihlpd
    pnkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisghpllnklddtenasayaana
    gvdnrecismdykqtqlcligckppigehwgkgspctqvavqpgdcpplelintviqdgd
    mvdtgfgamdfttlqanksevpldictsickypdyikmvsepygdslffylrreqmfvrh
    lfnragtvgenvpddlyikgsgstanlassnyfptpsgsmvtsdaqifnkpywlqraqgh
    nngicwgnqlfvtvvdttrstnmslcaaistsettykntnfkeylrhgeeydlqfifqlc
    kitltadvmtyihsmnstiledwnedplkkytfwevnlkekfsadldqfplgrkfllqlg
    l
    

  • Chain 'E':
    No sequence available.