PDB entry 3o9j

View 3o9j on RCSB PDB site
Description: Influenza NA in complex with compound 5
Class: hydrolase
Keywords: Neuraminidase, HYDROLASE
Deposited on 2010-08-04, released 2010-12-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus (A/duck/Ukraine/1/1963(H3N8)) [TaxId:385580]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07599 (0-386)
      • conflict (212)
    Domains in SCOPe 2.05: d3o9ja_
  • Heterogens: RP6, CA, NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o9jA (A:)
    tymnnteaicdakgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
    khsngtvkdrspfrtlmsvevgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
    vavihyggvptdvvnswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
    iigqtdisfngghieecscypndgkvecvcrdnwtgtnrpvlvispdlsyrvgylcagip
    sdtprgedtqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
    tqtskeqirkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
    ssivmcgvdyevadwswhdgailpfdi