PDB entry 3o9h
View 3o9h on RCSB PDB site
Description: Crystal Structure of wild-type HIV-1 Protease in complex with kd26
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, drug resistance, drug design, Protease inhibitors, AIDS, Aspartyl protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2010-08-04, released
2011-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-11-08, with a file datestamp of
2017-11-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: Gag-Pol, pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3o9ha_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: Gag-Pol, pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3o9hb_ - Heterogens: PO4, ACT, K2E, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3o9hA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3o9hB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf