PDB entry 3o9g

View 3o9g on RCSB PDB site
Description: Crystal Structure of wild-type HIV-1 Protease in complex with af53
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, drug resistance, drug design, Protease inhibitors, AIDS, Aspartyl protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-08-04, released 2011-08-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.177
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: Gag-Pol, pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90K99 (0-98)
      • engineered mutation (6)
    Domains in SCOPe 2.04: d3o9ga_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: Gag-Pol, pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90K99 (0-98)
      • engineered mutation (6)
    Domains in SCOPe 2.04: d3o9gb_
  • Heterogens: PO4, F53, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o9gA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o9gB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptpvniigrnlltqigctlnf