PDB entry 3o9c
View 3o9c on RCSB PDB site
Description: Crystal Structure of wild-type HIV-1 Protease in complex with kd20
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, drug resistance, drug design, Protease inhibitors, AIDS, Aspartyl protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2010-08-04, released
2011-08-10
The last revision prior to the SCOPe 2.03 freeze date was dated
2011-09-28, with a file datestamp of
2011-09-23.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.177
AEROSPACI score: 0.51
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: Gag-Pol, pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3o9ca_ - Chain 'B':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: Gag-Pol, pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3o9cb_ - Heterogens: K20, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3o9cA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3o9cB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf