PDB entry 3o95

View 3o95 on RCSB PDB site
Description: Crystal Structure of Human DPP4 Bound to TAK-100
Class: hydrolase,signaling protein/inhibitor
Keywords: protease and 8-bladed beta-propeller domain, Aminopeptidase, Cell membrane, Glycoprotein, Hydrolase, Membrane, Protease, Secreted, Serine protease, Signal-anchor, Transmembrane, SIGNALING PROTEIN, HYDROLASE,SIGNALING PROTEIN, HYDROLASE,SIGNALING PROTEIN-INHIBITOR complex
Deposited on 2010-08-03, released 2011-01-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.19
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ADCP2, CD26, DPP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3o95a1, d3o95a2
  • Chain 'B':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ADCP2, CD26, DPP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27487 (12-739)
      • expression tag (7-11)
    Domains in SCOPe 2.03: d3o95b1, d3o95b2
  • Chain 'C':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ADCP2, CD26, DPP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3o95c1, d3o95c2
  • Chain 'D':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ADCP2, CD26, DPP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3o95d1, d3o95d2
  • Heterogens: NAG, 01T, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o95A (A:)
    adpggshhhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygns
    svflenstfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqlitee
    ripnntqwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeee
    vfsaysalwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptv
    kffvvntdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmd
    icdydessgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicy
    fqidkkdctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtcls
    celnpercqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqn
    vqmpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwaty
    lasteniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriai
    wgwsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrns
    tvmsraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasst
    ahqhiythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o95A (A:)
    rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
    hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
    vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
    gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
    tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
    lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
    gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
    sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiil
    netkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfd
    grgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmv
    lgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqve
    yllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfi
    kqcfslp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o95B (B:)
    adpggshhhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygns
    svflenstfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqlitee
    ripnntqwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeee
    vfsaysalwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptv
    kffvvntdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmd
    icdydessgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicy
    fqidkkdctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtcls
    celnpercqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqn
    vqmpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwaty
    lasteniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriai
    wgwsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrns
    tvmsraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasst
    ahqhiythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o95B (B:)
    hhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflens
    tfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntq
    wvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysa
    lwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvnt
    dslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydes
    sgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkd
    ctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnper
    cqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskk
    ldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteni
    ivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsygg
    yvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsrae
    nfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiyt
    hmshfikqcfslp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3o95C (C:)
    adpggshhhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygns
    svflenstfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqlitee
    ripnntqwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeee
    vfsaysalwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptv
    kffvvntdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmd
    icdydessgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicy
    fqidkkdctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtcls
    celnpercqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqn
    vqmpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwaty
    lasteniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriai
    wgwsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrns
    tvmsraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasst
    ahqhiythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o95C (C:)
    ktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefgh
    sindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwspv
    ghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspng
    tflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssvt
    natsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwncl
    varqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitkg
    twevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysvs
    fskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiiln
    etkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfdg
    rgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmvl
    gsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqvey
    llihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfik
    qcfslp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3o95D (D:)
    adpggshhhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygns
    svflenstfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqlitee
    ripnntqwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeee
    vfsaysalwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptv
    kffvvntdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmd
    icdydessgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicy
    fqidkkdctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtcls
    celnpercqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqn
    vqmpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwaty
    lasteniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriai
    wgwsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrns
    tvmsraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasst
    ahqhiythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o95D (D:)
    rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
    hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
    vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
    gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
    tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
    lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
    gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
    sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiil
    netkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfd
    grgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmv
    lgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqve
    yllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfi
    kqcfslp