PDB entry 3o8u

View 3o8u on RCSB PDB site
Description: Conformational plasticity of p38 MAP kinase DFG motif mutants in response to inhibitor binding
Class: transferase
Keywords: Transferase
Deposited on 2010-08-03, released 2010-09-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.224
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: CSBP, CSBP1, CSBP2, CSPB1, MAPK14, MXI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539
      • engineered mutation (168)
    Domains in SCOPe 2.06: d3o8ua_
  • Heterogens: BMU, BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o8uA (A:)
    msqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildyglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o8uA (A:)
    rptfyrqelnktiwevperyqnlspvgsgsvcaafdtktglrvavkklsrpfqsiihakr
    tyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddhv
    qfliyqilrglkyihsadiihrdlkpsnlavnedcelkildygatrwyrapeimlnwmhy
    nqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiq
    sltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepva
    dpydqsfesrdllidewksltydevisfvppp