PDB entry 3o7y

View 3o7y on RCSB PDB site
Description: Crystal Structure of E.Coli Branching Enzyme in complex with linear oligosaccharides
Class: transferase
Keywords: Branching enzyme, maltoheptaose, linear polysaccharide ,starch biosynthetic pathway, TRANSFERASE
Deposited on 2010-08-01, released 2010-09-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.18
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-alpha-glucan-branching enzyme
    Species: Escherichia coli [TaxId:562]
    Gene: glgB, b3432, JW3395
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o7ya1, d3o7ya2, d3o7ya3
  • Chain 'B':
    Compound: 1,4-alpha-glucan-branching enzyme
    Species: Escherichia coli [TaxId:562]
    Gene: glgB, b3432, JW3395
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o7yb1, d3o7yb2, d3o7yb3
  • Chain 'C':
    Compound: 1,4-alpha-glucan-branching enzyme
    Species: Escherichia coli [TaxId:562]
    Gene: glgB, b3432, JW3395
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o7yc1, d3o7yc2, d3o7yc3
  • Chain 'D':
    Compound: 1,4-alpha-glucan-branching enzyme
    Species: Escherichia coli [TaxId:562]
    Gene: glgB, b3432, JW3395
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o7yd1, d3o7yd2, d3o7yd3
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o7yA (A:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o7yA (A:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehstliynygrrevsnflvgnalywierfgidalrvdavasmiyrggrenleaieflrn
    tnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymkldpvyrq
    yhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayygwmwafp
    gkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhkamheldf
    dpygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilnt
    dsmhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o7yB (B:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o7yB (B:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdprentliynygrrevsnflvgnalywierfgidalrvdavasmiyrdipnefggr
    enleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtl
    dymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanl
    rayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnlty
    rhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfgin
    qpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3o7yC (C:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o7yC (C:)
    hlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwel
    fipgahngqlykyemidangnlrlksdpyafeaqrpetaslicglpekvvqteerkkanq
    fdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdgsw
    gyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnlye
    hsliynygrrevsnflvgnalywierfgidalrvdavasmiyrenleaieflrntnrilg
    eqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymkldpvyrqyhhdkl
    tfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayygwmwafpgkkllf
    mgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhkamheldfdpygfe
    wlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntdsmhyh
    gsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3o7yD (D:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o7yD (D:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdgrenleaieflr
    ntnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymkldpvyr
    qyhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayygwmwaf
    pgkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhkamheld
    fdpygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreiln
    tdsmhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae