PDB entry 3o7v

View 3o7v on RCSB PDB site
Description: crystal structure of human hiwi1 (v361m) paz domain (residues 277-399) in complex with 14-mer rna (12-bp + 2-nt overhang) containing 2'-och3 at its 3'-end
Deposited on 2010-08-01, released 2011-01-12
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA (5'-r(*gp*cp*gp*ap*ap*up*ap*up*up*cp*gp*cp*up*(omu))-3')
    Species: synthetic, synthetic
  • Chain 'X':
    Compound: Piwi-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HIWI, Piwi-like protein 1, PIWIL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96J94
      • engineered mutation (85)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records:
    >3o7vX (X:)
setvldfmfnfyhqteehkfqeqvskeliglvvltkynnktyrvddidwdqnpkstfkka
dgsevsfleyyrkqynqeitdlkqpmlvsqpkrrrgpggtlpgpamlipelcyltgltdk
mrnd

    Sequence, based on observed residues (ATOM records):
    >3o7vX (X:)
etvldfmfnfyhqteehkfqeqvskeliglvvltkynnktyrvddidwdqnpkstfkkad
gsevsfleyyrkqynqeitdlkqpmlvsqpkgpamlipelcyltglt