PDB entry 3o7t

View 3o7t on RCSB PDB site
Description: Crystal Structure of Cyclophilin A from Moniliophthora perniciosa
Class: isomerase
Keywords: Cyclophilin, peptidyl-prolyl cis-trans isomerase, ISOMERASE
Deposited on 2010-07-31, released 2011-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.168
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cyclophilin a
  Species: Moniliophthora perniciosa [TaxId:153609]
  Database cross-references and differences (RAF-indexed):
  • PDB 3O7T (0-163)
  Domains in SCOPe 2.08: d3o7ta_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3o7tA (A:)
  shmanvffnisindkpegrivfklydeavpktaknfrelatgqhgfgykdsifhrvipqf
  mlqggdftrhngtggksiygekfadenfqvkhtkpgllsmanagantngsqffittvpts
  wldgkhvvfgeviegldivrkvegkgsasgktnatikitdcgtv