PDB entry 3o7a

View 3o7a on RCSB PDB site
Description: crystal structure of phf13 in complex with h3k4me3
Deposited on 2010-07-30, released 2010-10-06
The last revision was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PHD finger protein 13 variant
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: h3k4me3 histone 11mer-peptide
    Species: Xenopus laevis, synthetic [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3o7aA (A:)
swdlvtcfcmkpfagrpmiecnechtwihlscakirksnvpevfvcqkcrds

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o7aB (B:)
artkqtarkst

    Sequence, based on observed residues (ATOM records):
    >3o7aB (B:)
artkqt