PDB entry 3o6z

View 3o6z on RCSB PDB site
Description: Structure of the D152A E.coli GDP-mannose hydrolase (yffh) in complex with Mg++
Class: hydrolase
Keywords: nudix, GDP_mannose, hydrolase, biofilm
Deposited on 2010-07-29, released 2011-05-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.238
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-mannose pyrophosphatase nudK
    Species: Escherichia coli [TaxId:83333]
    Gene: b2467, JW2451, nudK, yffH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37128 (Start-190)
      • engineered mutation (151)
    Domains in SCOPe 2.08: d3o6za_
  • Chain 'B':
    Compound: GDP-mannose pyrophosphatase nudK
    Species: Escherichia coli [TaxId:83333]
    Gene: b2467, JW2451, nudK, yffH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37128 (Start-190)
      • engineered mutation (151)
    Domains in SCOPe 2.08: d3o6zb_
  • Heterogens: MG, CL, PEG, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o6zA (A:)
    mtqqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktv
    vlirqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfelym
    spggvtelihffiaeysdnqranagggvedeaievlelpfsqalemiktgeirdgktvll
    lnylqtshlmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o6zA (A:)
    tqqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktvv
    lirqfrvatwvngnesgqliescaglldndepevcirkeaieetyevgevrklfelymsp
    ggvtelihffiaeysdnqrdeaievlelpfsqalemiktgeirdgktvlllnylqtshlm
    d
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o6zB (B:)
    mtqqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktv
    vlirqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfelym
    spggvtelihffiaeysdnqranagggvedeaievlelpfsqalemiktgeirdgktvll
    lnylqtshlmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o6zB (B:)
    qqitlikdkilsdnyftlhnitydltrkdgvirhkrevydrgngatillyntkkktvvli
    rqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfelymspg
    gvtelihffiaeysdnqranagggvedeaievlelpfsqalemiktgeirdgktvlllny
    lqtshlmd