PDB entry 3o6j

View 3o6j on RCSB PDB site
Description: Crystal Structure of 4-Chlorocatechol Dioxygenase from Rhodococcus opacus 1CP in complex with hydroxyquinol
Class: oxidoreductase
Keywords: beta barrel, oxidoreductase
Deposited on 2010-07-29, released 2011-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chlorocatechol 1,2-dioxygenase
    Species: Rhodococcus opacus [TaxId:37919]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3o6ja_
  • Chain 'B':
    Compound: Chlorocatechol 1,2-dioxygenase
    Species: Rhodococcus opacus [TaxId:37919]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3o6jb_
  • Heterogens: FE, MYY, HQN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o6jA (A:)
    mantrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvd
    svsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitg
    avidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgql
    mnsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidi
    dgetwqlvdfnfilqhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o6jA (A:)
    antrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvds
    vsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitga
    vidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgqlm
    nsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidid
    getwqlvdfnfilqhn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o6jB (B:)
    mantrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvd
    svsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitg
    avidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgql
    mnsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidi
    dgetwqlvdfnfilqhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o6jB (B:)
    antrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvds
    vsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitga
    vidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgqlm
    nsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidid
    getwqlvdfnfilqhn