PDB entry 3o5z

View 3o5z on RCSB PDB site
Description: Crystal structure of the SH3 domain from p85beta subunit of phosphoinositide 3-kinase (PI3K)
Class: protein binding
Keywords: Src homology 3 domain, Protein binding
Deposited on 2010-07-28, released 2011-08-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.216
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 3-kinase regulatory subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3R2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o5za_
  • Chain 'B':
    Compound: Phosphatidylinositol 3-kinase regulatory subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3R2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o5zb_
  • Heterogens: CL, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o5zA (A:)
    gplgsmagpegfqyralypfrrerpedlellpgdvlvvsraalqalgvaeggercpqsvg
    wmpglnertrqrgdfpgtyveflgpvalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o5zA (A:)
    gpegfqyralypfrrerpedlellpgdvlvvsraalqalgvaeggercpqsvgwmpglne
    rtrqrgdfpgtyveflgpvala
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o5zB (B:)
    gplgsmagpegfqyralypfrrerpedlellpgdvlvvsraalqalgvaeggercpqsvg
    wmpglnertrqrgdfpgtyveflgpvalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o5zB (B:)
    egfqyralypfrrerpedlellpgdvlvvsraalqalgvaeggercpqsvgwmpglnert
    rqrgdfpgtyveflgpva