PDB entry 3o5t

View 3o5t on RCSB PDB site
Description: Structure of DraG-GlnZ complex with ADP
Class: hydrolase/transcription
Keywords: ADP binding, HYDROLASE-TRANSCRIPTION complex
Deposited on 2010-07-28, released 2011-10-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-03-13, with a file datestamp of 2013-03-08.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.153
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dinitrogenase reductase activacting glicohydrolase
    Species: Azospirillum brasilense [TaxId:192]
    Gene: draG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3o5ta_
  • Chain 'B':
    Compound: PII-like protein Pz
    Species: Azospirillum brasilense [TaxId:192]
    Gene: glnZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3o5tb_
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o5tA (A:)
    mtdhsirsralgaylglacgdalgatvefltkgeiahqygvhkhikgggwlklpagqvtd
    dtemsihlgrailaapewdarraaeefavwlkgvpvdvgdttrrgirrfimhgtlsepes
    eyhagngaamrnlpvalatlgddaaferwtveqahithcnamsdaatltlghmvrrlvlg
    gdvrdvrdesnkliakhrqfkfqpyrglatayivdtmqtvmhyyfqtdsvescvvetvnq
    ggdadttgaiagmlagatygvetipprwlrkldrdvyneicaqvdgllarapalkqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o5tA (A:)
    dhsirsralgaylglacgdalgatvefltkgeiahqygvhkhikgggwlklpagqvtddt
    emsihlgrailaapewdarraaeefavwlkgvpvdvgdttrrgirrfimhgtlsepesey
    hagngaamrnlpvalatlgddaaferwtveqahithcnamsdaatltlghmvrrlvlggd
    vrdvrdesnkliakhrqfkfqpyrglatayivdtmqtvmhyyfqtdsvescvvetvnqgg
    dadttgaiagmlagatygvetipprwlrkldrdvyneicaqvdgllarapalkqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o5tB (B:)
    mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqkgqteiyrgaeysvsflpkvk
    vevavsddqyeqvveaiqkaantgrigdgkifvldiaqavrirtgetnteal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o5tB (B:)
    mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqkvsflpkvkvevavsddqyeq
    vveaiqkaantgrigdgkifvldiaqavrirtgetnteal