PDB entry 3o5p

View 3o5p on RCSB PDB site
Description: Fk1 domain mutant A19T of FKBP51, crystal form IV
Class: isomerase
Keywords: Fk-506 binding domain, Hsp90 cochaperone, immunophiline, peptidyl-prolyl isomerase, ISOMERASE
Deposited on 2010-07-28, released 2011-06-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.112
AEROSPACI score: 1.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase FKBP5
    Species: Homo sapiens [TaxId:9606]
    Gene: AIG6, FKBP5, FKBP51
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13451 (3-127)
      • expression tag (0-2)
      • see remark 999 (6)
    Domains in SCOPe 2.03: d3o5pa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3o5pA (A:)
gapatvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshd
rnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffei
elldfkge