PDB entry 3o52

View 3o52 on RCSB PDB site
Description: Structure of the E.coli GDP-mannose hydrolase (yffh) in complex with tartrate
Class: hydrolase
Keywords: nudix, GDP_mannose, hydrolase, biofilm, tartrate, Nudix fold, GDP-mannose hydrolase
Deposited on 2010-07-27, released 2011-05-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.215
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-mannose pyrophosphatase nudK
    Species: Escherichia coli [TaxId:83333]
    Gene: b2467, JW2451, nudK, yffH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3o52a_
  • Chain 'B':
    Compound: GDP-mannose pyrophosphatase nudK
    Species: Escherichia coli [TaxId:83333]
    Gene: b2467, JW2451, nudK, yffH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3o52b_
  • Chain 'C':
    Compound: GDP-mannose pyrophosphatase nudK
    Species: Escherichia coli [TaxId:83333]
    Gene: b2467, JW2451, nudK, yffH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3o52c_
  • Chain 'D':
    Compound: GDP-mannose pyrophosphatase nudK
    Species: Escherichia coli [TaxId:83333]
    Gene: b2467, JW2451, nudK, yffH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3o52d_
  • Chain 'E':
    Compound: GDP-mannose pyrophosphatase nudK
    Species: Escherichia coli [TaxId:83333]
    Gene: b2467, JW2451, nudK, yffH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3o52e_
  • Heterogens: TAR, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o52A (A:)
    mtqqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktv
    vlirqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfelym
    spggvtelihffiaeysdnqranagggvededievlelpfsqalemiktgeirdgktvll
    lnylqtshlmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o52A (A:)
    qqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktvvl
    irqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfelymsp
    ggvtelihffiaeysdievlelpfsqalemiktgeirdgktvlllnylqtshlmd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o52B (B:)
    mtqqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktv
    vlirqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfelym
    spggvtelihffiaeysdnqranagggvededievlelpfsqalemiktgeirdgktvll
    lnylqtshlmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o52B (B:)
    qqitlikdkilsdnyftlhnitydltrkdgevirkrevydrgngatillyntkkktvvli
    rqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfelymspg
    gvtelihffiaeysdndievlelpfsqalemiktgeirdgktvlllnylqtshlmd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3o52C (C:)
    mtqqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktv
    vlirqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfelym
    spggvtelihffiaeysdnqranagggvededievlelpfsqalemiktgeirdgktvll
    lnylqtshlmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o52C (C:)
    qqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktvvl
    irqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfelymsp
    ggvtelihffiaeysdndievlelpfsqalemiktgeirdgktvlllnylqtshlmd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3o52D (D:)
    mtqqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktv
    vlirqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfelym
    spggvtelihffiaeysdnqranagggvededievlelpfsqalemiktgeirdgktvll
    lnylqtshlmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o52D (D:)
    qitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktvvli
    rqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfelymspg
    gvtelihffiaeysdnqraedievlelpfsqalemiktgeirdgktvlllnylqtshlmd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3o52E (E:)
    mtqqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktv
    vlirqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfelym
    spggvtelihffiaeysdnqranagggvededievlelpfsqalemiktgeirdgktvll
    lnylqtshlmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o52E (E:)
    tqqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktvv
    lirqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfelyms
    pggvtelihffiaeysddievlelpfsqalemiktgeirdgktvlllnylqtshlmd