PDB entry 3o4r

View 3o4r on RCSB PDB site
Description: Crystal Structure of Human Dehydrogenase/Reductase (SDR family) member 4 (DHRS4)
Class: oxidoreductase
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, dehydrogenase/reductase, OXIDOREDUCTASE
Deposited on 2010-07-27, released 2010-08-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-08-04, with a file datestamp of 2010-07-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.212
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehydrogenase/reductase SDR family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DHRS4, UNQ851/PRO1800
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3o4ra_
  • Chain 'B':
    Compound: Dehydrogenase/reductase SDR family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DHRS4, UNQ851/PRO1800
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3o4rb_
  • Chain 'C':
    Compound: Dehydrogenase/reductase SDR family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DHRS4, UNQ851/PRO1800
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3o4rc_
  • Chain 'D':
    Compound: Dehydrogenase/reductase SDR family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DHRS4, UNQ851/PRO1800
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3o4rd_
  • Heterogens: NAP, EDO, EPE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o4rA (A:)
    smassgmtrrdplankvalvtastdgigfaiarrlaqdgahvvvssrkqqnvdqavatlq
    geglsvtgtvchvgkaedrerlvatavklhggidilvsnaavnpffgsimdvteevwdkt
    ldinvkapalmtkavvpemekrgggsvvivssiaafspspgfspynvsktallgltktla
    ielaprnirvnclapgliktsfsrmlwmdkekeesmketlrirrlgepedcagivsflcs
    edasyitgetvvvgggtpsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o4rA (A:)
    trrdplankvalvtastdgigfaiarrlaqdgahvvvssrkqqnvdqavatlqgeglsvt
    gtvchvgkaedrerlvatavklhggidilvsnaavnpffgsimdvteevwdktldinvka
    palmtkavvpemekrgggsvvivssiaafspspgfspynvsktallgltktlaielaprn
    irvnclapgliktsfsrmlwmdkekeesmketlrirrlgepedcagivsflcsedasyit
    getvvvgggtpsrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o4rB (B:)
    smassgmtrrdplankvalvtastdgigfaiarrlaqdgahvvvssrkqqnvdqavatlq
    geglsvtgtvchvgkaedrerlvatavklhggidilvsnaavnpffgsimdvteevwdkt
    ldinvkapalmtkavvpemekrgggsvvivssiaafspspgfspynvsktallgltktla
    ielaprnirvnclapgliktsfsrmlwmdkekeesmketlrirrlgepedcagivsflcs
    edasyitgetvvvgggtpsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o4rB (B:)
    rdplankvalvtastdgigfaiarrlaqdgahvvvssrkqqnvdqavatlqgeglsvtgt
    vchvgkaedrerlvatavklhggidilvsnaavnpffgsimdvteevwdktldinvkapa
    lmtkavvpemekrgggsvvivssiaafspspgfspynvsktallgltktlaielaprnir
    vnclapgliktsfsrmlwmdkekeesmketlrirrlgepedcagivsflcsedasyitge
    tvvvgggtpsrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3o4rC (C:)
    smassgmtrrdplankvalvtastdgigfaiarrlaqdgahvvvssrkqqnvdqavatlq
    geglsvtgtvchvgkaedrerlvatavklhggidilvsnaavnpffgsimdvteevwdkt
    ldinvkapalmtkavvpemekrgggsvvivssiaafspspgfspynvsktallgltktla
    ielaprnirvnclapgliktsfsrmlwmdkekeesmketlrirrlgepedcagivsflcs
    edasyitgetvvvgggtpsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o4rC (C:)
    rrdplankvalvtastdgigfaiarrlaqdgahvvvssrkqqnvdqavatlqgeglsvtg
    tvchvgkaedrerlvatavklhggidilvsnaavnpffgsimdvteevwdktldinvkap
    almtkavvpemekrgggsvvivssiaafspspgfspynvsktallgltktlaielaprni
    rvnclapgliktsfsrmlwmdkekeesmketlrirrlgepedcagivsflcsedasyitg
    etvvvgggtpsrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3o4rD (D:)
    smassgmtrrdplankvalvtastdgigfaiarrlaqdgahvvvssrkqqnvdqavatlq
    geglsvtgtvchvgkaedrerlvatavklhggidilvsnaavnpffgsimdvteevwdkt
    ldinvkapalmtkavvpemekrgggsvvivssiaafspspgfspynvsktallgltktla
    ielaprnirvnclapgliktsfsrmlwmdkekeesmketlrirrlgepedcagivsflcs
    edasyitgetvvvgggtpsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o4rD (D:)
    dplankvalvtastdgigfaiarrlaqdgahvvvssrkqqnvdqavatlqgeglsvtgtv
    chvgkaedrerlvatavklhggidilvsnaavnpffgsimdvteevwdktldinvkapal
    mtkavvpemekrgggsvvivssiaafspspgfspynvsktallgltktlaielaprnirv
    nclapgliktsfsrmlwmdkekeesmketlrirrlgepedcagivsflcsedasyitget
    vvvgggtpsrl