PDB entry 3o46

View 3o46 on RCSB PDB site
Description: Crystal structure of the PDZ domain of MPP7
Class: protein binding
Keywords: pdz domain, structural genomics consortium, SGC, PROTEIN BINDING
Deposited on 2010-07-26, released 2010-08-04
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-08-04, with a file datestamp of 2010-07-30.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.184
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAGUK p55 subfamily member 7
    Species: Homo sapiens [TaxId:9606]
    Gene: MPP7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3o46a_
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3o46A (A:)
gsdsvkiirlvknreplgatikkdeqtgaiivarimrggaadrsglihvgdelrevngip
vedkrpeeiiqilaqsqgaitfkiipgskeetp

    Sequence, based on observed residues (ATOM records): (download) 
    >3o46A (A:)
svkiirlvknreplgatikkdeqtgaiivarimrggaadrsglihvgdelrevngipved
krpeeiiqilaqsqgaitfkiipg