PDB entry 3o3t

View 3o3t on RCSB PDB site
Description: Crystal Structure Analysis of M32A mutant of human CLIC1
Class: transport protein
Keywords: CLIC, Glutathione Transferase, thioredoxin, ion channel, domain interface, TRANSPORT PROTEIN
Deposited on 2010-07-26, released 2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.231
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloride intracellular channel protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CLIC1, G6, NCC27
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00299 (Start-240)
      • engineered mutation (31)
    Domains in SCOPe 2.07: d3o3ta1, d3o3ta2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o3tA (A:)
    maeeqpqvelfvkagsdgakigncpfsqrlfavlwlkgvtfnvttvdtkrrtetvqklcp
    ggqlpfllygtevhtdtnkieefleavlcpprypklaalnpesntagldifakfsayikn
    snpalndnlekgllkalkvldnyltsplpeevdetsaedegvsqrkfldgneltladcnl
    lpklhivqvvckkyrgftipeafrgvhrylsnayareefastcpddeeielayeqvakal
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o3tA (A:)
    pqvelfvkagsdgakigncpfsqrlfavlwlkgvtfnvttvdtkrrtetvqklcpggqlp
    fllygtevhtdtnkieefleavlcpprypklaalnpesntagldifakfsayiknsnpal
    ndnlekgllkalkvldnyltsplpeevdetsaedegvsqrkfldgneltladcnllpklh
    ivqvvckkyrgftipeafrgvhrylsnayareefastcpddeeielayeqvakalk