PDB entry 3o3q

View 3o3q on RCSB PDB site
Description: Crystal structure of "L44F/M67I/L73V/A103G/deletion 104-106/F108Y/V109L/L111I/C117V/R119G/deletion 120-122" mutant form of Human acidic fibroblast growth factor
Class: Heparin-binding protein
Keywords: beta-trefoil, Heparin-binding protein
Deposited on 2010-07-25, released 2011-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.172
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered mutation (49)
      • engineered mutation (72)
      • engineered mutation (78)
      • engineered mutation (108)
      • engineered mutation (110-111)
      • engineered mutation (113)
      • engineered mutation (119)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d3o3qa_
  • Chain 'B':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered mutation (49)
      • engineered mutation (72)
      • engineered mutation (78)
      • engineered mutation (108)
      • engineered mutation (110-111)
      • engineered mutation (113)
      • engineered mutation (119)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d3o3qb_
  • Chain 'C':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230 (Start-139)
      • engineered mutation (49)
      • engineered mutation (72)
      • engineered mutation (78)
      • engineered mutation (108)
      • engineered mutation (110-111)
      • engineered mutation (113)
      • engineered mutation (119)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d3o3qc_
  • Chain 'D':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230 (Start-139)
      • engineered mutation (49)
      • engineered mutation (72)
      • engineered mutation (78)
      • engineered mutation (108)
      • engineered mutation (110-111)
      • engineered mutation (113)
      • engineered mutation (119)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d3o3qd_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o3qA (A:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgev
    yikstetgqylaidtdglvygsqtpneeclflerleenhyntyiskkhgwylgikkngsv
    kgthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o3qA (A:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyikstetgqylaidt
    dglvygsqtpneeclflerleenhyntyiskkhgwylgikkngsvkgthygqkailflpl
    pvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o3qB (B:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgev
    yikstetgqylaidtdglvygsqtpneeclflerleenhyntyiskkhgwylgikkngsv
    kgthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o3qB (B:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyikstetgqylaidt
    dglvygsqtpneeclflerleenhyntyiskkhgwylgikkngsvkgthygqkailflpl
    pv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3o3qC (C:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgev
    yikstetgqylaidtdglvygsqtpneeclflerleenhyntyiskkhgwylgikkngsv
    kgthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o3qC (C:)
    ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyikstetgqylai
    dtdglvygsqtpneeclflerleenhyntyiskkhgwylgikkngsvkgthygqkailfl
    plpvssd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3o3qD (D:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgev
    yikstetgqylaidtdglvygsqtpneeclflerleenhyntyiskkhgwylgikkngsv
    kgthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o3qD (D:)
    ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyikstetgqylai
    dtdglvygsqtpneeclflerleenhyntyiskkhgwylgikkngsvkgthygqkailfl
    plpvssd