PDB entry 3o2u

View 3o2u on RCSB PDB site
Description: s. cerevisiae ubc12
Deposited on 2010-07-22, released 2010-09-15
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NEDD8-conjugating enzyme Ubc12
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: UBC12, YLR306W, L2142.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52491 (2-189)
      • expression tag (0-1)
  • Chain 'B':
    Compound: NEDD8-conjugating enzyme Ubc12
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: UBC12, YLR306W, L2142.3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3o2uA (A:)
    gsmlklrqlqkkkqkenensssiqpnlsaarirlkrdldsldlpptvtlnvitspdsadr
    sqspklevivrpdegyynygsinfnldfnevypieppkvvclkkifhpnidlkgnvclni
    lredwspaldlqsiitgllflflepnpndplnkdaakllcegekefaeavrltmsggsie
    hvkydnivsp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o2uB (B:)
    gsmlklrqlqkkkqkenensssiqpnlsaarirlkrdldsldlpptvtlnvitspdsadr
    sqspklevivrpdegyynygsinfnldfnevypieppkvvclkkifhpnidlkgnvclni
    lredwspaldlqsiitgllflflepnpndplnkdaakllcegekefaeavrltmsggsie
    hvkydnivsp
    

    Sequence, based on observed residues (ATOM records):
    >3o2uB (B:)
    lklrqlqkkkqkenenssspnlsaarirlkrdldsldlpptvtlnvitspdsadrsqspk
    levivrpdegyynygsinfnldfnevypieppkvvclkkifhpnidlkgnvclnilredw
    spaldlqsiitgllflflepnpndplnkdaakllcegekefaeavrltmsggsiehvkyd
    nivsp