PDB entry 3o2s

View 3o2s on RCSB PDB site
Description: crystal structure of the human symplekin-ssu72 complex
Deposited on 2010-07-22, released 2010-10-06
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Symplekin
    Species: Homo sapiens [TaxId:9606]
    Gene: SYMPK, SPK
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: RNA polymerase II subunit A C-terminal domain phosphatase SSU72
    Species: Homo sapiens [TaxId:9606]
    Gene: SSU72, HSPC182, PNAS-120
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o2sA (A:)
    mgsshhhhhhssglvprgshmttservvdllnqaalitndskitvlkqvqeliinkdptl
    ldnfldeiiafqadksievrkfvigfieeackrdielllklianlnmllrdenvnvvkka
    iltmtqlykvalqwmvksrviselqeacwdmvsamagdiillldsdndgirthaikfveg
    livtlsprmadseiprrqehdisldriprdhpyiqynvlweegkaaleqllkfmvhpais
    sinlttalgslaniarqrpmfmseviqayetlhanlpptlaksqvssvrknlklhllsvl
    khpaslefqaqittllvdlgtpqaeiarnmpsskdtrkrprddsdstlkkm
    

    Sequence, based on observed residues (ATOM records):
    >3o2sA (A:)
    mttservvdllnqaalitndskitvlkqvqeliinkdptlldnfldeiiafqadksievr
    kfvigfieeackrdielllklianlnmllrdenvnvvkkailtmtqlykvalqwmvksrv
    iselqeacwdmvsamagdiillldsdndgirthaikfveglivtlsprmadseiprrqeh
    disldriprdhpyiqynvlweegkaaleqllkfmvhpaissinlttalgslaniarqrpm
    fmseviqayetlhanlpptlaksqvssvrknlklhllsvlkhpaslefqaqittllvdlg
    tpqaeiarnmp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o2sB (B:)
    mgsshhhhhhssglvprgshmpssplrvavvcssnqnrsmeahnilskrgfsvrsfgtgt
    hvklpgpapdkpnvydfkttydqmyndllrkdkelytqngilhmldrnkrikprperfqn
    ckdlfdliltceervydqvvedlnsreqetcqpvhvvnvdiqdnheeatlgaflicelcq
    ciqhtedmeneidellqefeeksgrtflhtvcfy
    

    Sequence, based on observed residues (ATOM records):
    >3o2sB (B:)
    plrvavvcssnqnrsmeahnilskrgfsvrsfgtgthvklpgpapdkpnvydfkttydqm
    yndllrkdkelytqngilhmldrnkrikprperfqnckdlfdliltceervydqvvedln
    sreqetcqpvhvvnvdiqdnheeatlgaflicelcqciqhtedmeneidellqefeeksg
    rtflhtvcfy