PDB entry 3o2q

View 3o2q on RCSB PDB site
Description: crystal structure of the human symplekin-ssu72-ctd phosphopeptide complex
Deposited on 2010-07-22, released 2010-10-06
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Symplekin
    Species: Homo sapiens [TaxId:9606]
    Gene: SYMPK, SPK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92797 (20-End)
      • expression tag (14-19)
  • Chain 'B':
    Compound: RNA polymerase II subunit A C-terminal domain phosphatase SSU72
    Species: Homo sapiens [TaxId:9606]
    Gene: SSU72, HSPC182, PNAS-120
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP77 (Start-213)
      • engineered mutation (31)
  • Chain 'D':
    Compound: Symplekin
    Species: Homo sapiens [TaxId:9606]
    Gene: SYMPK, SPK
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: RNA polymerase II subunit A C-terminal domain phosphatase SSU72
    Species: Homo sapiens [TaxId:9606]
    Gene: SSU72, HSPC182, PNAS-120
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP77 (Start-213)
      • engineered mutation (31)
  • Chain 'F':
    Compound: RNA polymerase II CTD Serine-5 phosphopeptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3O2Q (0-5)
  • Heterogens: PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o2qA (A:)
    mgsshhhhhhssglvprgshmttservvdllnqaalitndskitvlkqvqeliinkdptl
    ldnfldeiiafqadksievrkfvigfieeackrdielllklianlnmllrdenvnvvkka
    iltmtqlykvalqwmvksrviselqeacwdmvsamagdiillldsdndgirthaikfveg
    livtlsprmadseiprrqehdisldriprdhpyiqynvlweegkaaleqllkfmvhpais
    sinlttalgslaniarqrpmfmseviqayetlhanlpptlaksqvssvrknlklhllsvl
    khpaslefqaqittllvdlgtpqaeiarnmpsskdtrkrprddsdstlkkm
    

    Sequence, based on observed residues (ATOM records):
    >3o2qA (A:)
    vprgshmttservvdllnqaalitndskitvlkqvqeliinkdptlldnfldeiiafqad
    ksievrkfvigfieeackrdielllklianlnmllrdenvnvvkkailtmtqlykvalqw
    mvksrviselqeacwdmvsamagdiillldsdndgirthaikfveglivtlsprmadsei
    prrqehdisldriprdhpyiqynvlweegkaaleqllkfmvhpaissinlttalgslani
    arqrpmfmseviqayetlhanlpptlaksqvssvrknlklhllsvlkhpaslefqaqitt
    llvdlgtpqaeiarnmp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o2qB (B:)
    mgsshhhhhhssglvprgshmpssplrvavvsssnqnrsmeahnilskrgfsvrsfgtgt
    hvklpgpapdkpnvydfkttydqmyndllrkdkelytqngilhmldrnkrikprperfqn
    ckdlfdliltceervydqvvedlnsreqetcqpvhvvnvdiqdnheeatlgaflicelcq
    ciqhtedmeneidellqefeeksgrtflhtvcfy
    

    Sequence, based on observed residues (ATOM records):
    >3o2qB (B:)
    lrvavvsssnqnrsmeahnilskrgfsvrsfgtgthvklpgpapdkpnvydfkttydqmy
    ndllrkdkelytqngilhmldrnkrikprperfqnckdlfdliltceervydqvvedlns
    reqetcqpvhvvnvdiqdnheeatlgaflicelcqciqhtedmeneidellqefeeksgr
    tflhtvcfy
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3o2qD (D:)
    mgsshhhhhhssglvprgshmttservvdllnqaalitndskitvlkqvqeliinkdptl
    ldnfldeiiafqadksievrkfvigfieeackrdielllklianlnmllrdenvnvvkka
    iltmtqlykvalqwmvksrviselqeacwdmvsamagdiillldsdndgirthaikfveg
    livtlsprmadseiprrqehdisldriprdhpyiqynvlweegkaaleqllkfmvhpais
    sinlttalgslaniarqrpmfmseviqayetlhanlpptlaksqvssvrknlklhllsvl
    khpaslefqaqittllvdlgtpqaeiarnmpsskdtrkrprddsdstlkkm
    

    Sequence, based on observed residues (ATOM records):
    >3o2qD (D:)
    mttservvdllnqaalitndskitvlkqvqeliinkdptlldnfldeiiafqadksievr
    kfvigfieeackrdielllklianlnmllrdenvnvvkkailtmtqlykvalqwmvksrv
    iselqeacwdmvsamagdiillldsdndgirthaikfveglivtlsprmadseiprrqeh
    disldriprdhpyiqynvlweegkaaleqllkfmvhpaissinlttalgslaniarqrpm
    fmseviqayetlhanlpptlaksqvssvrknlklhllsvlkhpaslefqaqittllvdlg
    tpqaeiarnmp
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3o2qE (E:)
    mgsshhhhhhssglvprgshmpssplrvavvsssnqnrsmeahnilskrgfsvrsfgtgt
    hvklpgpapdkpnvydfkttydqmyndllrkdkelytqngilhmldrnkrikprperfqn
    ckdlfdliltceervydqvvedlnsreqetcqpvhvvnvdiqdnheeatlgaflicelcq
    ciqhtedmeneidellqefeeksgrtflhtvcfy
    

    Sequence, based on observed residues (ATOM records):
    >3o2qE (E:)
    ssplrvavvsssnqnrsmeahnilskrgfsvrsfgtgthvklpgpapdkpnvydfkttyd
    qmyndllrkdkelytqngilhmldrnkrikprperfqnckdlfdliltceervydqvved
    lnsreqetcqpvhvvnvdiqdnheeatlgaflicelcqciqhtedmeneidellqefeek
    sgrtflhtvcfy
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >3o2qF (F:)
    ptspsy