PDB entry 3o2m

View 3o2m on RCSB PDB site
Description: Crystal Structure of JNK1-alpha1 isoform complex with a biaryl tetrazol (A-82118)
Class: transferase/inhibitor
Keywords: Serine Threonine Protein Kinase, ATP binding, Phosphorylation, Kinase-Inhibitor complex, TRANSFERASE-INHIBITOR complex
Deposited on 2010-07-22, released 2011-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-14, with a file datestamp of 2011-09-09.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.233
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: JNK1, MAPK8, PRKM8, SAPK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45983 (Start-363)
      • engineered mutation (182)
      • engineered mutation (184)
      • variant (207)
      • see remark 999 (246)
      • see remark 999 (257)
    Domains in SCOPe 2.07: d3o2ma_
  • Chain 'B':
    Compound: Mitogen-activated protein kinase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: JNK1, MAPK8, PRKM8, SAPK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45983 (Start-363)
      • engineered mutation (182)
      • engineered mutation (184)
      • variant (207)
      • see remark 999 (246)
      • see remark 999 (257)
    Domains in SCOPe 2.07: d3o2mb_
  • Chain 'F':
    Compound: C-Jun-amino-terminal kinase-interacting protein 1, JIP1, 10MER PEPTIDE
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: C-Jun-amino-terminal kinase-interacting protein 1, JIP1, 10MER PEPTIDE
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 46A, SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o2mA (A:)
    msrskrdnnfysveigdstftvlkryqnlkpigsgaqgivcaaydailernvaikklsrp
    fqnqthakrayrelvlmkcvnhkniigllnvftpqksleefqdvyivmelmdanlcqviq
    meldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsf
    mmepevvtryyrapevilgmgykenvdiwsvgcimgemvchkilfpgrdyidqwnkvieq
    lgtpcpafmkklqptvrnyvenrpkyagysfeklfpdvlfpadsehnklkasqardllsk
    mlvidaskrisvdealqhpyinvwydpseaeapppkipdkqlderehtieewkeliykev
    mdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o2mA (A:)
    dnnfysveigdstftvlkryqnlkpigsgaqgivcaaydailernvaikklsrpfqnqth
    akrayrelvlmkcvnhkniigllnvftpqksleefqdvyivmelmdanlcqviqmeldhe
    rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmmepev
    vtryyrapevilgmgykenvdiwsvgcimgemvchkilfpgrdyidqwnkvieqlgtpcp
    afmkklqptvrnyvenrpkyagysfeklfpdvlfpadsehnklkasqardllskmlvida
    skrisvdealqhpyinvwydpseaeapppkipdkqlderehtieewkeliykevmdle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o2mB (B:)
    msrskrdnnfysveigdstftvlkryqnlkpigsgaqgivcaaydailernvaikklsrp
    fqnqthakrayrelvlmkcvnhkniigllnvftpqksleefqdvyivmelmdanlcqviq
    meldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsf
    mmepevvtryyrapevilgmgykenvdiwsvgcimgemvchkilfpgrdyidqwnkvieq
    lgtpcpafmkklqptvrnyvenrpkyagysfeklfpdvlfpadsehnklkasqardllsk
    mlvidaskrisvdealqhpyinvwydpseaeapppkipdkqlderehtieewkeliykev
    mdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o2mB (B:)
    dnnfysveigdstftvlkryqnlkpigsgaqgivcaaydailernvaikklsrpfqnqth
    akrayrelvlmkcvnhkniigllnvftpqksleefqdvyivmelmdanlcqviqmeldhe
    rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmmepev
    vtryyrapevilgmgykenvdiwsvgcimgemvchkilfpgrdyidqwnkvieqlgtpcp
    afmkklqptvrnyvenrpkyagysfeklfpdvlfpadsehnklkasqardllskmlvida
    skrisvdealqhpyinvwydpseaeapppkipdkqlderehtieewkeliykevmdle
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.