PDB entry 3o2i

View 3o2i on RCSB PDB site
Description: The crystal structure of a functionally unknown protein from Leptospirillum sp. Group II UBA
Deposited on 2010-07-22, released 2010-09-22
The last revision was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Leptospirillum rubarum [TaxId:419542]
    Gene: UBAL2_80490115
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Leptospirillum rubarum [TaxId:419542]
    Gene: UBAL2_80490115
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Uncharacterized protein
    Species: Leptospirillum rubarum [TaxId:419542]
    Gene: UBAL2_80490115
    Database cross-references and differences (RAF-indexed):
  • Heterogens: DTT, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o2iA (A:)
    mgsshhhhhhssgrenlyfqgmrgddmhiyelvsrdrthpvriyllhseywtedefynll
    leafqrssasdwhlqilevskylvtahgfveagglqeigfpgelsktevrrrinaflgkd
    rsdgs
    

    Sequence, based on observed residues (ATOM records):
    >3o2iA (A:)
    dmhiyelvsrdrthpvriyllhseywtedefynllleafqrssasdwhlqilevskylvt
    ahgfveagglqeigfpgelsktevrrrinaflg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o2iB (B:)
    mgsshhhhhhssgrenlyfqgmrgddmhiyelvsrdrthpvriyllhseywtedefynll
    leafqrssasdwhlqilevskylvtahgfveagglqeigfpgelsktevrrrinaflgkd
    rsdgs
    

    Sequence, based on observed residues (ATOM records):
    >3o2iB (B:)
    dmhiyelvsrdrthpvriyllhseywtedefynllleafqrssasdwhlqilevskylvt
    ahgfveagglqeigfpgelsktevrrrinaflgkdr
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3o2iC (C:)
    mgsshhhhhhssgrenlyfqgmrgddmhiyelvsrdrthpvriyllhseywtedefynll
    leafqrssasdwhlqilevskylvtahgfveagglqeigfpgelsktevrrrinaflgkd
    rsdgs
    

    Sequence, based on observed residues (ATOM records):
    >3o2iC (C:)
    dmhiyelvsrdrthpvriyllhseywtedefynllleafqrssasdwhlqilevskylvt
    ahgfveagglqeigfpgelsktevrrrinaflg