PDB entry 3o2h

View 3o2h on RCSB PDB site
Description: E. coli ClpS in complex with a Leu N-end rule peptide
Class: peptide binding protein
Keywords: adaptor, protein-peptide complex, peptide-binding protein, N-end rule peptide, PEPTIDE BINDING PROTEIN
Deposited on 2010-07-22, released 2011-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.2
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease adaptor protein clpS
    Species: Escherichia coli [TaxId:83333]
    Gene: clpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3o2ha_
  • Chain 'B':
    Compound: DNA protection during starvation protein
    Species: Escherichia coli, synthetic [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o2hA (A:)
    gktndwldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratql
    mlavhyqgkaicgvftaevaetkvamvnkyarenehpllctleka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o2hA (A:)
    qlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgka
    icgvftaevaetkvamvnkyarenehpllctleka
    

  • Chain 'B':
    No sequence available.