PDB entry 3o2g

View 3o2g on RCSB PDB site
Description: Crystal Structure of Human gamma-butyrobetaine,2-oxoglutarate dioxygenase 1 (BBOX1)
Class: oxidoreductase
Keywords: GAMMA-BUTYROBETAINE HYDROXYLASE, GAMMA-BUTYROBETAINE, 2-OXOGLUTARATE DIOXYGENASE 1, OXIDOREDUCTASE, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2010-07-22, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.149
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-butyrobetaine dioxygenase
    Species: Homo sapiens [TaxId:9606]
    Gene: BBOX1, BBH, BBOX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75936 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d3o2ga1, d3o2ga2, d3o2ga3
  • Heterogens: ZN, OGA, NM2, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o2gA (A:)
    smactiqkaealdgahlmqilwydeeeslypavwlrdncpcsdcyldsakarkllveald
    vnigikglifdrkkvyitwpdehysefqadwlkkrcfskqaraklqrelffpecqywgse
    lqlptldfedvlrydehaykwlstlkkvgivrltgasdkpgevsklgkrmgflyltfygh
    twqvqdkidannvayttgklsfhtdypalhhppgvqllhcikqtvtggdseivdgfnvcq
    klkknnpqafqilsstfvdftdigvdycdfsvqskhkiielddkgqvvrinfnnatrdti
    fdvpvervqpfyaalkefvdlmnskeskftfkmnpgdvitfdnwrllhgrrsyeagteis
    rhlegayadwdvvmsrlrilrqrvengn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o2gA (A:)
    smactiqkaealdgahlmqilwydeeeslypavwlrdncpcsdcyldsakarkllveald
    vnigikglifdrkkvyitwpdehysefqadwlkkrcfskqaraklqrelffpecqywgse
    lqlptldfedvlrydehaykwlstlkkvgivrltgasdkpgevsklgkrmgflyltfygh
    twqvqdkidannvayttgklsfhtdypalhhppgvqllhcikqtvtggdseivdgfnvcq
    klkknnpqafqilsstfvdftdigvdycdfsvqskhkiielddkgqvvrinfnnatrdti
    fdvpvervqpfyaalkefvdlmnskeskftfkmnpgdvitfdnwrllhgrrsyeagteis
    rhlegayadwdvvmsrlrilrqrven