PDB entry 3o2b

View 3o2b on RCSB PDB site
Description: E. coli ClpS in complex with a Phe N-end rule peptide
Class: peptide binding protein
Keywords: adaptor, protein-peptide complex, peptide-binding protein, N-end rule peptide, PEPTIDE BINDING PROTEIN
Deposited on 2010-07-22, released 2011-12-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.213
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease adaptor protein clpS
    Species: Escherichia coli [TaxId:83333]
    Gene: clpS, yljA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3o2ba_
  • Chain 'B':
    Compound: Phe N-end rule peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3O2B (0-9)
  • Chain 'C':
    Compound: ATP-dependent Clp protease adaptor protein clpS
    Species: Escherichia coli [TaxId:83333]
    Gene: clpS, yljA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3o2bc_
  • Chain 'D':
    Compound: Phe N-end rule peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3O2B (0-End)
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3o2bA (A:)
gktndwldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratql
mlavhyqgkaicgvftaevaetkvamvnkyarenehpllctleka

    Sequence, based on observed residues (ATOM records): (download) 
    >3o2bA (A:)
kppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaevae
tkvamvnkyarenehpllctleka

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3o2bC (C:)
gktndwldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratql
mlavhyqgkaicgvftaevaetkvamvnkyarenehpllctleka

  • Chain 'D':
    No sequence available.