PDB entry 3o28

View 3o28 on RCSB PDB site
Description: Ligand-binding domain of GluA2 (flip) ionotropic glutamate receptor in complex with an allosteric modulator
Class: transport protein
Keywords: Transport Protein, Membrane Protein, Fusion protein, chimera protein
Deposited on 2010-07-22, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (2-116)
      • linker (117-118)
    • Uniprot P19491 (119-261)
    Domains in SCOPe 2.07: d3o28a_
  • Heterogens: O28, GLU, SO4, DMS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o28A (A:)
    ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlk
    lseqgvldklknkwwydkgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o28A (A:)
    nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
    ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
    saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
    kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlkls
    eqgvldklknkwwydkgecg