PDB entry 3o27

View 3o27 on RCSB PDB site
Description: The crystal structure of C68 from the hybrid virus-plasmid pSSVx
Deposited on 2010-07-22, released 2011-01-19
The last revision was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.252
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Sulfolobus islandicus [TaxId:43080]
    Gene: orfc68
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Putative uncharacterized protein
    Species: Sulfolobus islandicus [TaxId:43080]
    Gene: orfc68
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o27A (A:)
    mrpgirklvvlnpraykggsghttfyllipkdiaealdikpddtfilnmeqkdgdivlsy
    krvkelki
    

    Sequence, based on observed residues (ATOM records):
    >3o27A (A:)
    girklvvlnprayhttfyllipkdiaealdikpddtfilnmeqkdgdivlsykrvkelki
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o27B (B:)
    mrpgirklvvlnpraykggsghttfyllipkdiaealdikpddtfilnmeqkdgdivlsy
    krvkelki
    

    Sequence, based on observed residues (ATOM records):
    >3o27B (B:)
    girklvvlnpratfyllipkdiaealdikpddtfilnmeqkdgdivlsykrvkelki