PDB entry 3o26

View 3o26 on RCSB PDB site
Description: The structure of salutaridine reductase from Papaver somniferum.
Class: oxidoreductase
Keywords: short chain dehydrogenase/reductases, OXIDOREDUCTASE
Deposited on 2010-07-22, released 2010-12-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.193
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Salutaridine reductase
    Species: Papaver somniferum [TaxId:3469]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o26a_
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o26A (A:)
    mpetcpntvtkrrcavvtggnkgigfeickqlssngimvvltcrdvtkgheaveklknsn
    henvvfhqldvtdpiatmssladfikthfgkldilvnnagvagfsvdadrfkamisdige
    dseelvkiyekpeaqelmsetyelaeeclkinyngvksvtevlipllqlsdsprivnvss
    stgslkyvsnetaleilgdgdalteeridmvvnmllkdfkenlietngwpsfgaayttsk
    aclnaytrvlankipkfqvncvcpglvktemnygignytaeegaehvvrialfpddgpsg
    ffydcselsaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o26A (A:)
    rrcavvtggnkgigfeickqlssngimvvltcrdvtkgheaveklknsnhenvvfhqldv
    tdpiatmssladfikthfgkldilvnnagvagfsvdadrfkamisdigedseelvkiyek
    peaqelmsetyelaeeclkinyngvksvtevlipllqlsdsprivnvssstgslkyvsne
    taleilgdgdalteeridmvvnmllkdfkenlietngwpsfgaayttskaclnaytrvla
    nkipkfqvncvcpglvktemnygignytaeegaehvvrialfpddgpsgffydc