PDB entry 3o24

View 3o24 on RCSB PDB site
Description: Crystal structure of the brevianamide F prenyltransferase FtmPT1 from Aspergillus fumigatus
Deposited on 2010-07-22, released 2010-12-08
The last revision was dated 2010-12-29, with a file datestamp of 2010-12-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.189
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Brevianamide F prenyltransferase
    Species: Aspergillus fumigatus [TaxId:5085]
    Gene: ftmPT1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, MES, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o24A (A:)
    mppappdqkpchqlqpapyralsesilfgsvdeerwwhstapilsrllissnydvdvqyk
    ylslyrhlvlpalgpypqrdpetgiiatqwrsgmvltglpiefsnnvaralirigvdpvt
    adsgtaqdpfnttrpkvyletaarllpgvdltrfyefetelvitkaeeavlqanpdlfrs
    pwksqiltamdlqksgtvlvkayfypqpksavtgrstedllvnairkvdregrfetqlan
    lqryierrrrglhvpgvtadkppataadkafdacsffphflstdlvepgksrvkfyaser
    hvnlqmvediwtfgglrrdpdalrglellrhfwadiqmregyytmprgfcelgkssagfe
    apmmfhfhldgsqspfpdpqmyvcvfgmnsrklveglttfyrrvgweemashyqanflan
    ypdedfekaahlcayvsfayknggayvtlynhsfnpvgdvsfpngsrshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3o24A (A:)
    pappdqkpchqlqpapyralsesilfgsvdeerwwhstapilsrllissnydvdvqykyl
    slyrhlvlpalgpypqrdpetgiiatqwrsgmvltglpiefsnnvaralirigvdpvtad
    sgtaqdpfnttrpkvyletaarllpgvdltrfyefetelvitkaeeavlqanpdlfrspw
    ksqiltamdlqksgtvlvkayfypqpksavtgrstedllvnairkvdregrfetqlanlq
    ryierrrrcsffphflstdlvepgksrvkfyaserhvnlqmvediwtfgglrrdpdalrg
    lellrhfwadiqmregyytmprgfcelgkssgfeapmmfhfhldgsqspfpdpqmyvcvf
    gmnsrklveglttfyrrvgweemashyqanflanypdedfekaahlcayvsfayknggay
    vtlynhsfnp