PDB entry 3o21

View 3o21 on RCSB PDB site
Description: High resolution structure of GluA3 N-terminal domain (NTD)
Class: transport protein
Keywords: Periplasmatic binding protein, Oligomerization, Membrane, TRANSPORT PROTEIN
Deposited on 2010-07-22, released 2011-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria3, Glur3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o21a_
  • Chain 'B':
    Compound: Glutamate receptor 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria3, Glur3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o21b_
  • Chain 'C':
    Compound: Glutamate receptor 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria3, Glur3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o21c_
  • Chain 'D':
    Compound: Glutamate receptor 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria3, Glur3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o21d_
  • Heterogens: NAG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o21A (A:)
    gfpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtn
    afcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkga
    ilsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriiee
    mdrrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganit
    gfqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqr
    vdvsrrgsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyem
    kvsgsrkagywneyerfvpfsgthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o21A (A:)
    fpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtna
    fcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkgai
    lsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriieem
    drrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganitg
    fqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqrv
    dvsgdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyemkvsgsr
    kagywneyerfvpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o21B (B:)
    gfpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtn
    afcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkga
    ilsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriiee
    mdrrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganit
    gfqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqr
    vdvsrrgsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyem
    kvsgsrkagywneyerfvpfsgthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o21B (B:)
    fpntisigglfmrntvqehsafrfavqlyntpfhlnyhvdhldssnsfsvtnafcsqfsr
    gvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkgailsllsyy
    kwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriieemdrrqekr
    ylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganitgfqivnne
    npmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqrvdvsagdc
    lavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyemkvsgsrkagywneye
    rfvpf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3o21C (C:)
    gfpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtn
    afcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkga
    ilsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriiee
    mdrrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganit
    gfqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqr
    vdvsrrgsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyem
    kvsgsrkagywneyerfvpfsgthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o21C (C:)
    fpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtna
    fcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkgai
    lsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriieem
    drrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganitg
    fqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqrv
    dvsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyemkvsgs
    rkagywneyerfvpf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3o21D (D:)
    gfpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtn
    afcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkga
    ilsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriiee
    mdrrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganit
    gfqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqr
    vdvsrrgsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyem
    kvsgsrkagywneyerfvpfsgthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o21D (D:)
    ntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtnafc
    sqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkgails
    llsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriieemdr
    rqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganitgfq
    ivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqrvdv
    srsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyemkvsgs
    rkagywneyerfvpf